Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protein CsbA (csbA)

This Recombinant Bacillus subtilis Protein CsbA (csbA) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Protein CsbA

UniProt

P37953

Expression Region

1-76

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITKAVFALFFPFMLVVLFTRVTFNHYVAIALTAALLFASYLKGYTETYFIVGLDVVSLV AGGLYMAKKAAEKKEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC14A (CDC14 Cell Division Cycle 14 Homolog A (S. cerevisiae), cdc14, hCDC14) (FITC)
MBS6176204-01 0.1 mL

CDC14A (CDC14 Cell Division Cycle 14 Homolog A (S. cerevisiae), cdc14, hCDC14) (FITC)

Sign In for Pricing
View Details
CDC14A (CDC14 Cell Division Cycle 14 Homolog A (S. cerevisiae), cdc14, hCDC14) (FITC)
MBS6176204-02 5x 0.1 mL

CDC14A (CDC14 Cell Division Cycle 14 Homolog A (S. cerevisiae), cdc14, hCDC14) (FITC)

Sign In for Pricing
View Details
2-Acetamido-2-deoxy-6-O- (β-D-2-acetamido-2-deoxyglucopyranosyl) -α-D-galactopyranose
001080 1 mg

2-Acetamido-2-deoxy-6-O- (β-D-2-acetamido-2-deoxyglucopyranosyl) -α-D-galactopyranose

Sign In for Pricing
View Details
SAT1 (Spermidine/Spermine N1-Acetyltransferase 1, SAT, DC21, KFSD, SSAT, KFSDX, SSAT-1) (FITC)
MBS6436718-01 0.1 mL

SAT1 (Spermidine/Spermine N1-Acetyltransferase 1, SAT, DC21, KFSD, SSAT, KFSDX, SSAT-1) (FITC)

Sign In for Pricing
View Details
SAT1 (Spermidine/Spermine N1-Acetyltransferase 1, SAT, DC21, KFSD, SSAT, KFSDX, SSAT-1) (FITC)
MBS6436718-02 5x 0.1 mL

SAT1 (Spermidine/Spermine N1-Acetyltransferase 1, SAT, DC21, KFSD, SSAT, KFSDX, SSAT-1) (FITC)

Sign In for Pricing
View Details
Hsa-miR-4681 miRNA Antagomir
orb1914810-01 10 nmol

Hsa-miR-4681 miRNA Antagomir

Sign In for Pricing
View Details