Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P66792

Expression Region

1-77

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLIKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL12 Antibody
46592 100 µL

KLHL12 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TTC33 Antibody [DyLight 594]
NBP2-97329DL594 0.1 mL

Rabbit Polyclonal TTC33 Antibody [DyLight 594]

Sign In for Pricing
View Details
Olivil
TN4708 5 mg

Olivil

Sign In for Pricing
View Details
Olfr1346 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4201107 1.0 µg DNA

Olfr1346 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Integrin αL CRISPR Activation Plasmid (h)
sc-402246-ACT 20 µg

Integrin αL CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MAP2K5 (Mitogen-Activated Protein Kinase Kinase 5, HsT17454, MAPKK5, MEK5, PRKMK5) (HRP)
248441-HRP 100 µL

MAP2K5 (Mitogen-Activated Protein Kinase Kinase 5, HsT17454, MAPKK5, MEK5, PRKMK5) (HRP)

Sign In for Pricing
View Details