Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P66791

Expression Region

1-77

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLIKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM1/LSD1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-10166R-PE-Cy5 100 µL

KDM1/LSD1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
DAXX Rabbit Polyclonal Antibody (Biotin)
orb2097691 100 µL

DAXX Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
OAEE00974-100T - CD8A Antibody
OAEE00974-100T 100 Tests

OAEE00974-100T - CD8A Antibody

Sign In for Pricing
View Details
C1QL4, NT (C1QL4, Complement C1q-like protein 4) (MaxLight 405)
MBS6279764-01 0.1 mL

C1QL4, NT (C1QL4, Complement C1q-like protein 4) (MaxLight 405)

Sign In for Pricing
View Details
C1QL4, NT (C1QL4, Complement C1q-like protein 4) (MaxLight 405)
MBS6279764-02 5x 0.1 mL

C1QL4, NT (C1QL4, Complement C1q-like protein 4) (MaxLight 405)

Sign In for Pricing
View Details
DSPG, Na
LP-R4-017-01 25 mg

DSPG, Na

Sign In for Pricing
View Details