Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P66791

Expression Region

1-77

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLIKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHADL sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
16014111 3x 1.0 µg

CHADL sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Monkey Anti Granulocyte macrophage colony stimulating factor antibody ELISA kit
GTR10418902 96 Well

Monkey Anti Granulocyte macrophage colony stimulating factor antibody ELISA kit

Sign In for Pricing
View Details
Rabbit Polyclonal PPP4R2 Antibody [Alexa Fluor 647]
NBP2-99605AF647 0.1 mL

Rabbit Polyclonal PPP4R2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Pdgfrb (NM_008809) Mouse Tagged ORF Clone Lentiviral Particle
MR225618L4V 200 µL

Pdgfrb (NM_008809) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Coprothermobacter proteolyticus GTPase obg (obg)
MBS1111021-01 0.02 mg (E-Coli)

Recombinant Coprothermobacter proteolyticus GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Coprothermobacter proteolyticus GTPase obg (obg)
MBS1111021-02 0.02 mg (Yeast)

Recombinant Coprothermobacter proteolyticus GTPase obg (obg)

Sign In for Pricing
View Details