Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P66791

Expression Region

1-77

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLIKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF-II, Human
E34M114H 5 µg

IGF-II, Human

Sign In for Pricing
View Details
PDLIM2 Mouse Monoclonal Antibody [Clone ID: OTI10C4]
TA502708 100 µL

PDLIM2 Mouse Monoclonal Antibody [Clone ID: OTI10C4]

Sign In for Pricing
View Details
HHIPL1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb930418 100 µL

HHIPL1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Ketohexokinase Rabbit pAb, Pacific Blue conjugated
orb2860192 100 µL

Ketohexokinase Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Ammonium Glycyrrhizinate
C16805-01 10 mM / 1 mL

Ammonium Glycyrrhizinate

Sign In for Pricing
View Details
Ammonium Glycyrrhizinate
C16805-02 100 mg

Ammonium Glycyrrhizinate

Sign In for Pricing
View Details