Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Duck hepatitis B virus Large envelope protein (S)

This Recombinant Duck hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 162-238.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen, Cleaved into the following chain:, 1. Truncated S protein

UniProt

P03145

Expression Region

162-238

Origin

Duck hepatitis B virus (strain United States/DHBV-16) (DHBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISPH YVGSCPWGCPGFLWTYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF488A conjugate, 0.1mg/mL
BNC882453-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RSPO1 (NM_001038633) Human Recombinant Protein
TP762458 50 µg

RSPO1 (NM_001038633) Human Recombinant Protein

Sign In for Pricing
View Details
Sycn (NM_026716) Mouse Tagged ORF Clone
MG200788 10 µg

Sycn (NM_026716) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Aspartate beta hydroxylase (ASPH) (NM_001164755) Human Recombinant Protein
TP328203M 100 µg

Aspartate beta hydroxylase (ASPH) (NM_001164755) Human Recombinant Protein

Sign In for Pricing
View Details
C1orf227 (SPATA45) (NM_001024601) Human Over-expression Lysate
LC422517 20 µg

C1orf227 (SPATA45) (NM_001024601) Human Over-expression Lysate

Sign In for Pricing
View Details
Iso E Super (Mixture of Isomers) (>80%)
TRC-I815500-10MG 10 mg

Iso E Super (Mixture of Isomers) (>80%)

Sign In for Pricing
View Details