Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus helveticus ATP synthase subunit c (atpE)

This Recombinant Lactobacillus helveticus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8YUJ6

Expression Region

1-77

Origin

Lactobacillus helveticus (strain DPC 4571)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFMSEAFKYLAASIAAGLAALAAALGNGKVISKTLEGMARQPESADNLRATMFIGVGLI EAVPILAIVVAFLILFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPEB4 Rabbit Polyclonal Antibody (Cy5.5)
orb1063740 100 µL

CPEB4 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
PLV3-U6-CLDN11-sgRNA1-Cas9-EGFP-Puro Plasmid
PVT72670 2 µg

PLV3-U6-CLDN11-sgRNA1-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal RAB30 Antibody (OTI3E7) [DyLight 488]
NBP2-73771G 0.1 mL

Mouse Monoclonal RAB30 Antibody (OTI3E7) [DyLight 488]

Sign In for Pricing
View Details
Fmoc-D-Trp (Boc) TentaGel® S AC Resin
SAD1128.1G 1 g

Fmoc-D-Trp (Boc) TentaGel® S AC Resin

Sign In for Pricing
View Details
Human Zinc finger with KRAB and SCAN domains 3 (ZKSCAN3) ELISA Kit
abx384408 96 Tests

Human Zinc finger with KRAB and SCAN domains 3 (ZKSCAN3) ELISA Kit

Sign In for Pricing
View Details
SLC29A3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
44086154 3x 1.0 µg DNA

SLC29A3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details