Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q49W06

Expression Region

1-77

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTLIMVLLILDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGIDLFLHRLTIV LSVIFFLLMLGISYFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Halorhodospira halophila Glycerol-3-phosphate acyltransferase (plsY), partial
MBS7063604 Inquire

Recombinant Halorhodospira halophila Glycerol-3-phosphate acyltransferase (plsY), partial

Sign In for Pricing
View Details
Ubiquitin Linkage Screening Kit III
RP10219K 1 Kit

Ubiquitin Linkage Screening Kit III

Sign In for Pricing
View Details
ATHB-52 Antibody
orb784904 2 mg

ATHB-52 Antibody

Sign In for Pricing
View Details
Astn2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4896403 1.0 µg DNA

Astn2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rat Collagen Alpha-1 (I) Chain (Col1A1) Elisa Kit
EKC40873 96 Tests

Rat Collagen Alpha-1 (I) Chain (Col1A1) Elisa Kit

Sign In for Pricing
View Details
CKR-10 (C-5)
sc-365531 200 µg/mL

CKR-10 (C-5)

Sign In for Pricing
View Details