Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus epidermidis Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q5HQU8

Expression Region

1-77

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTLIIVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII LAILFFVLMFCISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQ-1S
B1279-25 25 mg

IQ-1S

Sign In for Pricing
View Details
Human L-phenylalanine (LPA) ELISA Kit
AE35310HU-01 48 Tests

Human L-phenylalanine (LPA) ELISA Kit

Sign In for Pricing
View Details
Human L-phenylalanine (LPA) ELISA Kit
AE35310HU-02 96 Tests

Human L-phenylalanine (LPA) ELISA Kit

Sign In for Pricing
View Details
Recombinant Arabidopsis MPK6 Protein, N-His
PR006012-01 50 µg

Recombinant Arabidopsis MPK6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Arabidopsis MPK6 Protein, N-His
PR006012-02 100 µg

Recombinant Arabidopsis MPK6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Arabidopsis MPK6 Protein, N-His
PR006012-03 1 mg

Recombinant Arabidopsis MPK6 Protein, N-His

Sign In for Pricing
View Details