Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q5HHN9

Expression Region

1-77

Origin

Staphylococcus aureus (strain COL)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UBIAD1 Antibody [DyLight 755]
NBP2-82046IR 0.1 mL

Rabbit Polyclonal UBIAD1 Antibody [DyLight 755]

Sign In for Pricing
View Details
PHKG2 Antibody
F54914-0.08ML 0.08 mL

PHKG2 Antibody

Sign In for Pricing
View Details
Procollagen II C-Terminal Propeptide
549446 200 µL

Procollagen II C-Terminal Propeptide

Sign In for Pricing
View Details
Hdgfrp3 (Hdgfl3) (NM_013886) Mouse Tagged Lenti ORF Clone
MR202094L4 10 µg

Hdgfrp3 (Hdgfl3) (NM_013886) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cytosolic Ovarian Carcinoma Antigen 1 (COVA1)
MBS2094534-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Cytosolic Ovarian Carcinoma Antigen 1 (COVA1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cytosolic Ovarian Carcinoma Antigen 1 (COVA1)
MBS2094534-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Cytosolic Ovarian Carcinoma Antigen 1 (COVA1)

Sign In for Pricing
View Details