Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q5HHN9

Expression Region

1-77

Origin

Staphylococcus aureus (strain COL)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf81 sgRNA CRISPR Lentivector (Human) (Target 1)
K0300202 1.0 µg DNA

C14orf81 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal HID1 Antibody (OTI2F4) [Biotin]
NBP2-72481B 0.1 mL

Mouse Monoclonal HID1 Antibody (OTI2F4) [Biotin]

Sign In for Pricing
View Details
Mouse TATA box binding protein/TBP-associated factors (TAF) ELISA Kit
EIA06403m 1 Kit

Mouse TATA box binding protein/TBP-associated factors (TAF) ELISA Kit

Sign In for Pricing
View Details
Mouse Cd226 Pre-designed siRNA Set A
SI102121A 1 Each

Mouse Cd226 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ONO-8590580 25mg
A19337-25 25 mg

ONO-8590580 25mg

Sign In for Pricing
View Details
1-BOC-2,3-Dihydropyrrole-4-boronic acid, pinacol ester
TRC-B201878-25MG 25 mg

1-BOC-2,3-Dihydropyrrole-4-boronic acid, pinacol ester

Sign In for Pricing
View Details