Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q6GB52

Expression Region

1-77

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-{[4-Amino-5- (4-methoxyphenyl) -4H-1,2,4-triazol-3-yl]sulfanyl}acetic acid
FMA33666-01 100 mg

2-{[4-Amino-5- (4-methoxyphenyl) -4H-1,2,4-triazol-3-yl]sulfanyl}acetic acid

Sign In for Pricing
View Details
2-{[4-Amino-5- (4-methoxyphenyl) -4H-1,2,4-triazol-3-yl]sulfanyl}acetic acid
FMA33666-02 1 g

2-{[4-Amino-5- (4-methoxyphenyl) -4H-1,2,4-triazol-3-yl]sulfanyl}acetic acid

Sign In for Pricing
View Details
Tert-Butyl 3- (piperidin-4-yloxy) azetidine-1-carboxylate hydrochloride
HY-W056504 1 Each

Tert-Butyl 3- (piperidin-4-yloxy) azetidine-1-carboxylate hydrochloride

Sign In for Pricing
View Details
ALKBH3 Protein Vector (Human) (pPM-N-D-C-HA)
PV321328 500 ng

ALKBH3 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Molnupiravir Impurity 21
RM-M151421-01 10 mg

Molnupiravir Impurity 21

Sign In for Pricing
View Details
Molnupiravir Impurity 21
RM-M151421-02 25 mg

Molnupiravir Impurity 21

Sign In for Pricing
View Details