Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q6GB52

Expression Region

1-77

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Astragaloside II
C14230-5mg 5 mg

Astragaloside II

Sign In for Pricing
View Details
Human Protein bassoon ELISA Kit
MBS9426886-01 96 Tests

Human Protein bassoon ELISA Kit

Sign In for Pricing
View Details
Human Protein bassoon ELISA Kit
MBS9426886-02 5x 96 Tests

Human Protein bassoon ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Galnt3 shRNA (UAS) - Lentiviral mouse Galnt3 shRNA (UAS) (100)
GTR15212946 1 Vial

Lentiviral mouse Galnt3 shRNA (UAS) - Lentiviral mouse Galnt3 shRNA (UAS) (100)

Sign In for Pricing
View Details
FAM105A siRNA (Human)
orb1858169-01 15 nmol

FAM105A siRNA (Human)

Sign In for Pricing
View Details
FAM105A siRNA (Human)
orb1858169-02 30 nmol

FAM105A siRNA (Human)

Sign In for Pricing
View Details