Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q6GIL2

Expression Region

1-77

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGFSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Evc Mouse Gene Knockout Kit (CRISPR)
KN505414 1 Kit

Evc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Znf512 3'UTR Luciferase Stable Cell Line
TU223905 1.0 mL

Znf512 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HPRT Rabbit mAb
MBS8602891-01 0.1 mL

HPRT Rabbit mAb

Sign In for Pricing
View Details
HPRT Rabbit mAb
MBS8602891-02 0.1 mL (AF405L)

HPRT Rabbit mAb

Sign In for Pricing
View Details
HPRT Rabbit mAb
MBS8602891-03 0.1 mL (AF405S)

HPRT Rabbit mAb

Sign In for Pricing
View Details
HPRT Rabbit mAb
MBS8602891-04 0.1 mL (AF610)

HPRT Rabbit mAb

Sign In for Pricing
View Details