Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q6GIL2

Expression Region

1-77

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGFSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn1r85 shRNA (UAS) - Lentiviral mouse Vmn1r85 shRNA (UAS, RFP) plasmid
GTR15135769 1 Vial

Lentiviral mouse Vmn1r85 shRNA (UAS) - Lentiviral mouse Vmn1r85 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Inhibitor of Kappa-Light Polypeptide Gene Enhancer In B Cells Kinase Beta (IkBKb) BioAssayTM ELISA Kit (Mouse)
025818 96 Tests

Inhibitor of Kappa-Light Polypeptide Gene Enhancer In B Cells Kinase Beta (IkBKb) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 23A (MMP23A) ELISA kit
YLA1064MO-01 48 Tests

Mouse Matrix Metalloproteinase 23A (MMP23A) ELISA kit

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 23A (MMP23A) ELISA kit
YLA1064MO-02 96 Tests

Mouse Matrix Metalloproteinase 23A (MMP23A) ELISA kit

Sign In for Pricing
View Details
Probable serine protease inhibitor 6 Antibody
MBS7194545 Inquire

Probable serine protease inhibitor 6 Antibody

Sign In for Pricing
View Details
Anti-alpha olf antibody
STJ93458 200 µl

Anti-alpha olf antibody

Sign In for Pricing
View Details