Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C17orf109 (C17orf109)

This Recombinant Human Uncharacterized protein C17orf109 (C17orf109) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf109

UniProt

Q71RC9

Expression Region

1-77

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATDFVQEMRAVGERLLLKLQRLPQAEPVEIVAFSVIILFTATVLLLLLIACSCCCTHC CCPERRGRKVQVQPTPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGAM1 Antibody
orb423744-01 5 µg

PGAM1 Antibody

Sign In for Pricing
View Details
PGAM1 Antibody
orb423744-02 20 µg

PGAM1 Antibody

Sign In for Pricing
View Details
PGAM1 Antibody
orb423744-03 100 µg

PGAM1 Antibody

Sign In for Pricing
View Details
Recombinant Striga asiatica Casparian strip membrane protein 1
orb2929784-01 20 µg

Recombinant Striga asiatica Casparian strip membrane protein 1

Sign In for Pricing
View Details
Recombinant Striga asiatica Casparian strip membrane protein 1
orb2929784-02 100 µg

Recombinant Striga asiatica Casparian strip membrane protein 1

Sign In for Pricing
View Details
Rat Contactin 3 (CNTN3) ELISA kit
QY-E10347 96 Tests

Rat Contactin 3 (CNTN3) ELISA kit

Sign In for Pricing
View Details