Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C17orf109 (C17orf109)

This Recombinant Human Uncharacterized protein C17orf109 (C17orf109) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf109

UniProt

Q71RC9

Expression Region

1-77

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATDFVQEMRAVGERLLLKLQRLPQAEPVEIVAFSVIILFTATVLLLLLIACSCCCTHC CCPERRGRKVQVQPTPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAP protein (His tag)
80R-3911 0.02 mg

DAP protein (His tag)

Sign In for Pricing
View Details
Ku70/80 Peptide
AF5472-BP 1 mg

Ku70/80 Peptide

Sign In for Pricing
View Details
MLK1/2 (phospho Thr312/266) Antibody
A8142-01 50 μL

MLK1/2 (phospho Thr312/266) Antibody

Sign In for Pricing
View Details
MLK1/2 (phospho Thr312/266) Antibody
A8142-02 100 µL

MLK1/2 (phospho Thr312/266) Antibody

Sign In for Pricing
View Details
Polycystin 2 Rabbit Polyclonal Antibody (PerCP)
orb2453500 100 µL

Polycystin 2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Recombinant Shigella Boydii gsiB Protein (aa 27-512)
VAng-Lsx08643-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii gsiB Protein (aa 27-512)

Sign In for Pricing
View Details