Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q7A1F4

Expression Region

1-77

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Complement Component 3a (C3a), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026091 96 Tests

Multiplex Assay Kit for Complement Component 3a (C3a), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Beta-Amyloid (1-42) Mouse Monoclonal Antibody (APC-Cy5.5)
orb2371020 100 µL

Beta-Amyloid (1-42) Mouse Monoclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
HA FITC antibody
10R-6756 0.1 mg

HA FITC antibody

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Microtubule Associated Protein 4 (MAP4)
MBS2093141-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Microtubule Associated Protein 4 (MAP4)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Microtubule Associated Protein 4 (MAP4)
MBS2093141-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Microtubule Associated Protein 4 (MAP4)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Microtubule Associated Protein 4 (MAP4)
MBS2093141-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Microtubule Associated Protein 4 (MAP4)

Sign In for Pricing
View Details