Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q7A1F4

Expression Region

1-77

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P66 beta (GATAD2B) Human Over-expression Lysate
orb1350042 100 µg

P66 beta (GATAD2B) Human Over-expression Lysate

Sign In for Pricing
View Details
PIC E001-250x250-PP-CRD/1 Facility & Office Signs (No Adhesive)
814274 1 Card (1 Panel (s) x 1 Pack)

PIC E001-250x250-PP-CRD/1 Facility & Office Signs (No Adhesive)

Sign In for Pricing
View Details
Tect3 (m2) : 293T Lysate
sc-123974 100 µg - 200 µL

Tect3 (m2) : 293T Lysate

Sign In for Pricing
View Details
1-Chloroisoquinoline-4- boronic acid
CSB-DT4559 1 g

1-Chloroisoquinoline-4- boronic acid

Sign In for Pricing
View Details
MMAB Human Gene Knockout Kit (CRISPR)
KN404290 1 Kit

MMAB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Podoplanin (F-3)
sc-376962 200 µg/mL

Podoplanin (F-3)

Sign In for Pricing
View Details