Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q7A1F4

Expression Region

1-77

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm10142 Protein Lysate (Mouse) with C-HA Tag
21684034 100 µg

Gm10142 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
HIF-1 beta Polyclonal Antibody
BT-AP09890-01 20 µL

HIF-1 beta Polyclonal Antibody

Sign In for Pricing
View Details
HIF-1 beta Polyclonal Antibody
BT-AP09890-02 50 µL

HIF-1 beta Polyclonal Antibody

Sign In for Pricing
View Details
HIF-1 beta Polyclonal Antibody
BT-AP09890-03 100 µL

HIF-1 beta Polyclonal Antibody

Sign In for Pricing
View Details
Dog Telomerase reverse transcriptase ELISA Kit
EK4313 Inquire

Dog Telomerase reverse transcriptase ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal DYKDDDDK Epitope Tag Antibody (F-tag-01) [mFluor Violet 450 SE]
NB500-554MFV450 0.1 mL

Mouse Monoclonal DYKDDDDK Epitope Tag Antibody (F-tag-01) [mFluor Violet 450 SE]

Sign In for Pricing
View Details