Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus epidermidis Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q8CPY2

Expression Region

1-77

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTLIIVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII LAILFFVLMFCISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Metalloproteinase inhibitor 4
E0130b 96 Tests

ELISA Kit For Metalloproteinase inhibitor 4

Sign In for Pricing
View Details
6α,3'-p-Dihydroxy paclitaxel-d5
HY-144561S 1 Each

6α,3'-p-Dihydroxy paclitaxel-d5

Sign In for Pricing
View Details
Uba2 Antibody
ABD13303 100 µg

Uba2 Antibody

Sign In for Pricing
View Details
Naphthol AS-MX Phosphate
41400004-1 1 g

Naphthol AS-MX Phosphate

Sign In for Pricing
View Details
Anti-C-C chemokine receptor type 9 CCR9 Antibody Picoband® Fluoro488 Conjugated
PA2122-Fluoro488 100 µg/Vial

Anti-C-C chemokine receptor type 9 CCR9 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Recombinant SFTSV Mgp1/membrane glycoprotein polyprotein, C-His
EVV27701 100 μg

Recombinant SFTSV Mgp1/membrane glycoprotein polyprotein, C-His

Sign In for Pricing
View Details