Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit L (ndhL)

This Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit L (ndhL) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit L, EC= 1.6.5.-, NAD (P) H dehydrogenase I subunit L, NDH-1 subunit L, NDH-L

UniProt

Q8KX34

Expression Region

1-77

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFDIPVETLLIATLYLSLSVTYLLVLPAGLYFYLNNRWYVASSIERLVMYFFVFFLFPG MLLLSPFLNFRPRRREV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF488A conjugate, 0.1mg/mL
BNC881982-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF647 conjugate, 0.1mg/mL
BNC471812-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details