Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q99VK3

Expression Region

1-77

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CSF2 Protein
CRP1359-01 10 µg

Recombinant Human CSF2 Protein

Sign In for Pricing
View Details
Recombinant Human CSF2 Protein
CRP1359-02 50 µg

Recombinant Human CSF2 Protein

Sign In for Pricing
View Details
Recombinant Human CSF2 Protein
CRP1359-03 500 µg

Recombinant Human CSF2 Protein

Sign In for Pricing
View Details
(S) -2-Amino-5-methoxytetralin HCl
FA146988-01 0.25 g

(S) -2-Amino-5-methoxytetralin HCl

Sign In for Pricing
View Details
(S) -2-Amino-5-methoxytetralin HCl
FA146988-02 0.5 g

(S) -2-Amino-5-methoxytetralin HCl

Sign In for Pricing
View Details
(S) -2-Amino-5-methoxytetralin HCl
FA146988-03 1 g

(S) -2-Amino-5-methoxytetralin HCl

Sign In for Pricing
View Details