Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG)

This Recombinant Staphylococcus aureus Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

Q99VK3

Expression Region

1-77

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII LSILFFVLMICISYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PHETA2 Pre-designed siRNA Set B
SI012077B 1 Each

Human PHETA2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
LUZP2 Rabbit Polyclonal Antibody (BF750)
orb2480300 100 µL

LUZP2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
SIAH2, ID (SIAH2, E3 ubiquitin-protein ligase SIAH2, Seven in absentia homolog 2) (MaxLight 650) discontinued
041728-ML650 100 µL

SIAH2, ID (SIAH2, E3 ubiquitin-protein ligase SIAH2, Seven in absentia homolog 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
ORAI2 Human Pre-designed siRNA Set A
HY-RS09823 1 Set

ORAI2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cediranib Maleate
C10837-10mg 10 mg

Cediranib Maleate

Sign In for Pricing
View Details
Rabbit anti-PSMB8/LMP7 Antibody, Affinity Purified
MBS3905370-01 0.01 mg

Rabbit anti-PSMB8/LMP7 Antibody, Affinity Purified

Sign In for Pricing
View Details