Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Q300 (Hpvc2)

This Recombinant Mouse Protein Q300 (Hpvc2) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Protein Q300

UniProt

Q02722

Expression Region

1-77

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKCHHAHLQFHFYKFWWEGETNLFYVCVCVCVCVCVCVCTLTCMCKSGGNLGCSSSGAI HCGVFVCVLIFEPGLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSS (NM_001001438) Human Over-expression Lysate
LC424356 20 µg

LSS (NM_001001438) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1'-rac-glycerol)-d30 Sodium Salt (major)
TRC-P160983-2.5MG 2.5 mg

1-Palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1'-rac-glycerol)-d30 Sodium Salt (major)

Sign In for Pricing
View Details
Tlcd4 Mouse Gene Knockout Kit (CRISPR)
KN517880 1 Kit

Tlcd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat CEACAM1/CD66a protein (His tag)
PDMR100013-01 20 µg

Recombinant Rat CEACAM1/CD66a protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CEACAM1/CD66a protein (His tag)
PDMR100013-02 100 µg

Recombinant Rat CEACAM1/CD66a protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CEACAM1/CD66a protein (His tag)
PDMR100013-03 500 µg

Recombinant Rat CEACAM1/CD66a protein (His tag)

Sign In for Pricing
View Details