Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Q300 (Hpvc2)

This Recombinant Mouse Protein Q300 (Hpvc2) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Protein Q300

UniProt

Q02722

Expression Region

1-77

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKCHHAHLQFHFYKFWWEGETNLFYVCVCVCVCVCVCVCTLTCMCKSGGNLGCSSSGAI HCGVFVCVLIFEPGLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EGF Like Domain Protein, Multiple 6 (EGFL6) ELISA Kit
RD-EGFL6-Hu-01 96 Tests

Human EGF Like Domain Protein, Multiple 6 (EGFL6) ELISA Kit

Sign In for Pricing
View Details
Human EGF Like Domain Protein, Multiple 6 (EGFL6) ELISA Kit
RD-EGFL6-Hu-02 48 Tests

Human EGF Like Domain Protein, Multiple 6 (EGFL6) ELISA Kit

Sign In for Pricing
View Details
Protein Z (PROZ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A9]
TA806742AM 100 µL

Protein Z (PROZ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A9]

Sign In for Pricing
View Details
HIV1 p24 Mouse monoclonal Antibody [12G4]
HA600010-50UL 50 µL

HIV1 p24 Mouse monoclonal Antibody [12G4]

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin 6/PRDX6 Protein (His Tag)
PKSH031178 100 µg

Recombinant Human Peroxiredoxin 6/PRDX6 Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS808482 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details