Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Q300 (Hpvc2)

This Recombinant Mouse Protein Q300 (Hpvc2) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Protein Q300

UniProt

Q02722

Expression Region

1-77

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKCHHAHLQFHFYKFWWEGETNLFYVCVCVCVCVCVCVCTLTCMCKSGGNLGCSSSGAI HCGVFVCVLIFEPGLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS800717 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS710493 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Dichloroacetic Acid-d1
TRC-D431829-500MG 500 mg

Dichloroacetic Acid-d1

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), 0.2mg/mL
BNUB0172-500 1x 500 µL

CD45 / LCA (135-4C5), 0.2mg/mL

Sign In for Pricing
View Details
BACE1 (NM_012104) Human Recombinant Protein
TP309115L 1 mg

BACE1 (NM_012104) Human Recombinant Protein

Sign In for Pricing
View Details
Mucin 3 (M3.1), CF488A conjugate, 0.1mg/mL
BNC880990-100 1x 100 µL

Mucin 3 (M3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details