Recombinant Duck hepatitis B virus Large envelope protein (S)
This Recombinant Duck hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 164-240.
Product Specifications
Product Name Alternative
Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen, Cleaved into the following chain:, 1. Truncated S protein
UniProt
P17194
Expression Region
164-240
Origin
Duck hepatitis B virus (isolate brown Shanghai duck S5) (DHBV)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISPH YVGSCPWGCPGFLWTYL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
