Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Duck hepatitis B virus Large envelope protein (S)

This Recombinant Duck hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 164-240.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen, Cleaved into the following chain:, 1. Truncated S protein

UniProt

P17194

Expression Region

164-240

Origin

Duck hepatitis B virus (isolate brown Shanghai duck S5) (DHBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISPH YVGSCPWGCPGFLWTYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
Cyclophilin B (PPIB) (26-216) Mouse Monoclonal Antibody [Clone ID: k2E2]
AM03177PU-S 50 µL

Cyclophilin B (PPIB) (26-216) Mouse Monoclonal Antibody [Clone ID: k2E2]

Sign In for Pricing
View Details
MMP-8 Antibody
8C0274-AAT 50 µg

MMP-8 Antibody

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details