Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Duck hepatitis B virus Large envelope protein (S)

This Recombinant Duck hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 164-240.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen, Cleaved into the following chain:, 1. Truncated S protein

UniProt

P17194

Expression Region

164-240

Origin

Duck hepatitis B virus (isolate brown Shanghai duck S5) (DHBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISPH YVGSCPWGCPGFLWTYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TrkA/NTRK1 Protein (aa 194-413, His Tag)
PKSH031278 100 µg

Recombinant Human TrkA/NTRK1 Protein (aa 194-413, His Tag)

Sign In for Pricing
View Details
Glutathione Synthetase Recombinant Rabbit Monoclonal Antibody [JB95-33]
ET7107-62 100 µL

Glutathione Synthetase Recombinant Rabbit Monoclonal Antibody [JB95-33]

Sign In for Pricing
View Details
N-Acetyl-4-aminosalicylic Acid-d3
TRC-A168327-50MG 50 mg

N-Acetyl-4-aminosalicylic Acid-d3

Sign In for Pricing
View Details
Recombinant Human CD27/TNFRSF7 Protein (Fc & His Tag)
PKSH032210-01 10 µg

Recombinant Human CD27/TNFRSF7 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Human CD27/TNFRSF7 Protein (Fc & His Tag)
PKSH032210-02 50 µg

Recombinant Human CD27/TNFRSF7 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Mfn1 Mouse Gene Knockout Kit (CRISPR)
KN310033RB 1 Kit

Mfn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details