Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P38388

Expression Region

1-77

Origin

Mycobacterium leprae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLTKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD105/Eng Antibody Picoband® (Cy3 Conjugate)
A02997-2-Cy3 100 µg/Vial

Anti-CD105/Eng Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
TAK1/MAP4K2 inhibitor 1
T10444-01 1 mg

TAK1/MAP4K2 inhibitor 1

Sign In for Pricing
View Details
TAK1/MAP4K2 inhibitor 1
T10444-02 5 mg

TAK1/MAP4K2 inhibitor 1

Sign In for Pricing
View Details
RBM12B Antibody
orb1559439-01 50 µL

RBM12B Antibody

Sign In for Pricing
View Details
RBM12B Antibody
orb1559439-02 100 µL

RBM12B Antibody

Sign In for Pricing
View Details
RBM12B Antibody
orb1559439-03 200 µL

RBM12B Antibody

Sign In for Pricing
View Details