Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P38388

Expression Region

1-77

Origin

Mycobacterium leprae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLTKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Brpf3 shRNA (UAS) - Lentiviral mouse Brpf3 shRNA (UAS) (100)
GTR15278838 1 Vial

Lentiviral mouse Brpf3 shRNA (UAS) - Lentiviral mouse Brpf3 shRNA (UAS) (100)

Sign In for Pricing
View Details
IL2 Receptor alpha (IL2RA) Human Over-expression Lysate
orb1341735 100 µg

IL2 Receptor alpha (IL2RA) Human Over-expression Lysate

Sign In for Pricing
View Details
Inf-1 Antibody
orb800719 2 mg

Inf-1 Antibody

Sign In for Pricing
View Details
PDCD4 Rabbit Polyclonal Antibody (Fluoro647)
orb3115406 100 µg

PDCD4 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Eastern newt Anterior gradient protein 2 Rabbit Polyclonal Antibody (APC)
orb2573180 200 µL

Eastern newt Anterior gradient protein 2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
IL1RAPL1 Rabbit Polyclonal Antibody (BF680)
orb1603612 100 µL

IL1RAPL1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details