Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protein-export membrane protein SecG (secG)

This Recombinant Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

P38388

Expression Region

1-77

Origin

Mycobacterium leprae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLTKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG2b-Purified (with Antibiotics)
MBS666111-01 0.1 mg

Mouse IgG2b-Purified (with Antibiotics)

Sign In for Pricing
View Details
Mouse IgG2b-Purified (with Antibiotics)
MBS666111-02 5x 0.1 mg

Mouse IgG2b-Purified (with Antibiotics)

Sign In for Pricing
View Details
Aprotinin, Bovine (New Zealand) (Pancreatic trypsin inhibitor) discontinued. See A2300-03
A2300-05-01 50 mg

Aprotinin, Bovine (New Zealand) (Pancreatic trypsin inhibitor) discontinued. See A2300-03

Sign In for Pricing
View Details
Aprotinin, Bovine (New Zealand) (Pancreatic trypsin inhibitor) discontinued. See A2300-03
A2300-05-02 100 mg

Aprotinin, Bovine (New Zealand) (Pancreatic trypsin inhibitor) discontinued. See A2300-03

Sign In for Pricing
View Details
Aprotinin, Bovine (New Zealand) (Pancreatic trypsin inhibitor) discontinued. See A2300-03
A2300-05-03 250 mg

Aprotinin, Bovine (New Zealand) (Pancreatic trypsin inhibitor) discontinued. See A2300-03

Sign In for Pricing
View Details
Aprotinin, Bovine (New Zealand) (Pancreatic trypsin inhibitor) discontinued. See A2300-03
A2300-05-04 500 mg

Aprotinin, Bovine (New Zealand) (Pancreatic trypsin inhibitor) discontinued. See A2300-03

Sign In for Pricing
View Details