Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4WNY7

Expression Region

1-78

Origin

Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDIAEMGKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFA EALGIFSFLIALLLMFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD34 Mouse mAb, FITC conjugated
orb3001846 100 µL

Human CD34 Mouse mAb, FITC conjugated

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)
MBS1219565-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)
MBS1219565-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)
MBS1219565-03 0.02 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)
MBS1219565-04 0.1 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)
MBS1219565-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O1:K1 / APEC ProP effector (proQ)

Sign In for Pricing
View Details