Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE)
This Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-78.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
A4WNY7
Expression Region
1-78
Origin
Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEGDIAEMGKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFA EALGIFSFLIALLLMFAV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DLR-TRPM6-Ra-96T 96 Tests
Rat Transient Receptor Potential Cation Channel Subfamily M, Member 6 (TRPM6) ELISA Kit
Sign In for Pricing
View Details 
OR80962-01 100 mg
9-Octyl-3,6-bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -9H-carbazole
Sign In for Pricing
View Details OR80962-02 250 mg
9-Octyl-3,6-bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -9H-carbazole
Sign In for Pricing
View Details OR80962-03 1 g
9-Octyl-3,6-bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -9H-carbazole
Sign In for Pricing
View Details OR80962-04 5 g
9-Octyl-3,6-bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -9H-carbazole
Sign In for Pricing
View Details