Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4WNY7

Expression Region

1-78

Origin

Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDIAEMGKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFA EALGIFSFLIALLLMFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SLCO2A1 Protein, N-His-SUMO
MBS1577272-01 0.1 mg

Recombinant Human SLCO2A1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human SLCO2A1 Protein, N-His-SUMO
MBS1577272-02 1 mg

Recombinant Human SLCO2A1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human SLCO2A1 Protein, N-His-SUMO
MBS1577272-03 5x 1 mg

Recombinant Human SLCO2A1 Protein, N-His-SUMO

Sign In for Pricing
View Details
IL-11Rα (D361) polyclonal antibody
BS9265 50ul

IL-11Rα (D361) polyclonal antibody

Sign In for Pricing
View Details
EYA3 Rabbit pAb (APR21602N)
APR21602N-01 50 µL

EYA3 Rabbit pAb (APR21602N)

Sign In for Pricing
View Details
EYA3 Rabbit pAb (APR21602N)
APR21602N-02 100 µL

EYA3 Rabbit pAb (APR21602N)

Sign In for Pricing
View Details