Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqzF (yqzF)

This Recombinant Bacillus subtilis Uncharacterized protein yqzF (yqzF) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein yqzF

UniProt

O32015

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRLLALLILVIPGAISALGIKLMRDTLFGHTIKPFSALWLQGLSGFIFFAIGLYVLAGF ILYRDRKRNQVSPRFRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Fibroblast Growth Factor 9 (FGF9) ELISA Kit
RD-FGF9-Ch-01 96 Tests

Chicken Fibroblast Growth Factor 9 (FGF9) ELISA Kit

Sign In for Pricing
View Details
Chicken Fibroblast Growth Factor 9 (FGF9) ELISA Kit
RD-FGF9-Ch-02 48 Tests

Chicken Fibroblast Growth Factor 9 (FGF9) ELISA Kit

Sign In for Pricing
View Details
BTBD15 (ZBTB44) Rabbit Polyclonal Antibody
TA369847 100 µL

BTBD15 (ZBTB44) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human B7H3 (CD276) activation kit by CRISPRa
GA112946 1 Kit

Human B7H3 (CD276) activation kit by CRISPRa

Sign In for Pricing
View Details
N-Fmoc-L-isoleucine
TRC-F625025-50G 50 g

N-Fmoc-L-isoleucine

Sign In for Pricing
View Details
Acetic Acid
TRC-A167640-5L 5 L

Acetic Acid

Sign In for Pricing
View Details