Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqzF (yqzF)

This Recombinant Bacillus subtilis Uncharacterized protein yqzF (yqzF) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein yqzF

UniProt

O32015

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRLLALLILVIPGAISALGIKLMRDTLFGHTIKPFSALWLQGLSGFIFFAIGLYVLAGF ILYRDRKRNQVSPRFRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF647 conjugate, 0.1mg/mL
BNC472959-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF640R conjugate, 0.1mg/mL
BNC402200-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABL1 Recombinant Rabbit monoclonal Antibody
HA750931 100 µL

ABL1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CLIC5 (Isoform 1) (160-173) Mouse Monoclonal Antibody [Clone ID: CLIC5-02]
AM26766RP-N 100 µg

CLIC5 (Isoform 1) (160-173) Mouse Monoclonal Antibody [Clone ID: CLIC5-02]

Sign In for Pricing
View Details
p-Nitrophenyl a-D-Glucopyranoside
TRC-N503650-5G 5 g

p-Nitrophenyl a-D-Glucopyranoside

Sign In for Pricing
View Details