Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqzF (yqzF)

This Recombinant Bacillus subtilis Uncharacterized protein yqzF (yqzF) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein yqzF

UniProt

O32015

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRLLALLILVIPGAISALGIKLMRDTLFGHTIKPFSALWLQGLSGFIFFAIGLYVLAGF ILYRDRKRNQVSPRFRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS700827 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
TRIM67 antibody
FNab08993 100 µg

TRIM67 antibody

Sign In for Pricing
View Details
CLEC10A (NM_006344) Human Recombinant Protein
TP720473L 500 µg

CLEC10A (NM_006344) Human Recombinant Protein

Sign In for Pricing
View Details
TEX11 Antibody
OC-440-01 50 μL

TEX11 Antibody

Sign In for Pricing
View Details
TEX11 Antibody
OC-440-02 100 µL

TEX11 Antibody

Sign In for Pricing
View Details
TEX11 Antibody
OC-440-03 1 mL

TEX11 Antibody

Sign In for Pricing
View Details