Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yuzA (yuzA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yuzA (yuzA) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yuzA

UniProt

O32087

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIQRICLVLTIIGAINWGLIGFFQFDLVAAIFGGQGSALSRIIYGLVGIAGLINLGLL FKPNEERSREEAANPEMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF4 Antibody, HRP conjugated
A69430-50UG 50 µg

RASSF4 Antibody, HRP conjugated

Sign In for Pricing
View Details
FXYD5 Antibody - middle region
ARP35225_P050-25UL 25 µL

FXYD5 Antibody - middle region

Sign In for Pricing
View Details
c-Src Rabbit Polyclonal Antibody
ES2062-01 50 µL

c-Src Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
c-Src Rabbit Polyclonal Antibody
ES2062-02 100 µL

c-Src Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CT47B1 Human siRNA Oligo Duplex (Locus ID 643311)
SR318740 1 Kit

CT47B1 Human siRNA Oligo Duplex (Locus ID 643311)

Sign In for Pricing
View Details
Sodium Benzo[a]pyrene-3-sulfate discontinued
466241-01 1 mg

Sodium Benzo[a]pyrene-3-sulfate discontinued

Sign In for Pricing
View Details