Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yuzA (yuzA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yuzA (yuzA) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yuzA

UniProt

O32087

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIQRICLVLTIIGAINWGLIGFFQFDLVAAIFGGQGSALSRIIYGLVGIAGLINLGLL FKPNEERSREEAANPEMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SACS-AS1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV747729 1.0 µg DNA

SACS-AS1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Phospho-PKA R2 (S99) Rabbit mAb
E60M1129 100 µL

Phospho-PKA R2 (S99) Rabbit mAb

Sign In for Pricing
View Details
Mouse (MOPC-21) Monoclonal Antibody IgG1 Isotype Control (FITC Conjugate)
CST 97146S 200 µL

Mouse (MOPC-21) Monoclonal Antibody IgG1 Isotype Control (FITC Conjugate)

Sign In for Pricing
View Details
Recombinant Human Testis-specific serine/threonine-protein kinase 3 (TSSK3)
CSB-EP850410HU-01 10 µg

Recombinant Human Testis-specific serine/threonine-protein kinase 3 (TSSK3)

Sign In for Pricing
View Details
Recombinant Human Testis-specific serine/threonine-protein kinase 3 (TSSK3)
CSB-EP850410HU-02 50 µg

Recombinant Human Testis-specific serine/threonine-protein kinase 3 (TSSK3)

Sign In for Pricing
View Details
Recombinant Human Testis-specific serine/threonine-protein kinase 3 (TSSK3)
CSB-EP850410HU-03 200 µg

Recombinant Human Testis-specific serine/threonine-protein kinase 3 (TSSK3)

Sign In for Pricing
View Details