Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yuzA (yuzA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yuzA (yuzA) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yuzA

UniProt

O32087

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIQRICLVLTIIGAINWGLIGFFQFDLVAAIFGGQGSALSRIIYGLVGIAGLINLGLL FKPNEERSREEAANPEMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphodiesterase 9A (PDE9A, High Affinity cGMP-specific 3',5'-cyclic Phosphodiesterase 9A, FLJ90181, HSPDE9A2) (MaxLight 550)
MBS6444739-01 0.1 mL

Phosphodiesterase 9A (PDE9A, High Affinity cGMP-specific 3',5'-cyclic Phosphodiesterase 9A, FLJ90181, HSPDE9A2) (MaxLight 550)

Sign In for Pricing
View Details
Phosphodiesterase 9A (PDE9A, High Affinity cGMP-specific 3',5'-cyclic Phosphodiesterase 9A, FLJ90181, HSPDE9A2) (MaxLight 550)
MBS6444739-02 5x 0.1 mL

Phosphodiesterase 9A (PDE9A, High Affinity cGMP-specific 3',5'-cyclic Phosphodiesterase 9A, FLJ90181, HSPDE9A2) (MaxLight 550)

Sign In for Pricing
View Details
2-Chloro-N-methyl-N- ((3R,4R) -4-methylpiperidin-3-yl) -7H-pyrrolo[2,3-d]pyrimidin-4-amine
OR1006077 100 mg

2-Chloro-N-methyl-N- ((3R,4R) -4-methylpiperidin-3-yl) -7H-pyrrolo[2,3-d]pyrimidin-4-amine

Sign In for Pricing
View Details
NOXA1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
32028151 3x 1.0 µg DNA

NOXA1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Hepatic leukemia Factor (HLF) Rat ELISA Kit
D9907 96 Tests

Hepatic leukemia Factor (HLF) Rat ELISA Kit

Sign In for Pricing
View Details
IFI35 (NM_005533) Human Recombinant Protein
E45H41731M5 20 µg

IFI35 (NM_005533) Human Recombinant Protein

Sign In for Pricing
View Details