Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0055 (TP_0055)

This Recombinant Treponema pallidum Uncharacterized protein TP_0055 (TP_0055) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0055

UniProt

O83094

Expression Region

1-78

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQIRLFAQSALVSVMGMGMVFAFLLLLICVVRCVGALVSSFGWDRGPDEGVGAAVPAGG ALAAAIAVAVHEKARSTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trans-p-Methoxycinnamaldehyde
ZAA68050 100 g

Trans-p-Methoxycinnamaldehyde

Sign In for Pricing
View Details
Mouse Monoclonal Rift Valley Fever Virus Nucleocapsid Antibody (AA11.1.B5.D10)
NBP3-14857-0.1mg 0.1 mg

Mouse Monoclonal Rift Valley Fever Virus Nucleocapsid Antibody (AA11.1.B5.D10)

Sign In for Pricing
View Details
CRYAB/Crystallin-α-B (Ab-45) Antibody
8B0896-AAT 50 µg

CRYAB/Crystallin-α-B (Ab-45) Antibody

Sign In for Pricing
View Details
PPP6R1 Antibody - N-terminal region : HRP (ARP55109_P050-HRP)
ARP55109_P050-HRP 100 µL

PPP6R1 Antibody - N-terminal region : HRP (ARP55109_P050-HRP)

Sign In for Pricing
View Details
C11orf68 (NM_001135635) Human Tagged ORF Clone
RC227913 10 µg

C11orf68 (NM_001135635) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human MED12 shRNA (UAS) - Lentiviral human MED12 shRNA (UAS, RFP) (25)
GTR15287315 1 Vial

Lentiviral human MED12 shRNA (UAS) - Lentiviral human MED12 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details