Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0055 (TP_0055)

This Recombinant Treponema pallidum Uncharacterized protein TP_0055 (TP_0055) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0055

UniProt

O83094

Expression Region

1-78

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQIRLFAQSALVSVMGMGMVFAFLLLLICVVRCVGALVSSFGWDRGPDEGVGAAVPAGG ALAAAIAVAVHEKARSTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUD4 CRISPR Activation Plasmid (m2)
sc-428673-ACT-2 20 µg

OTUD4 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
STXBP6 3'UTR Lenti-reporter-Luc Vector
45814081 1.0 µg

STXBP6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Gon7 Antibody
orb854285 2 mg

Gon7 Antibody

Sign In for Pricing
View Details
pEnCMV-Padi2-C655A-3XFLAG Plasmid
PVT32649 2 µg

pEnCMV-Padi2-C655A-3XFLAG Plasmid

Sign In for Pricing
View Details
IL-27B Polyclonal Antibody
MBS2579024-01 0.025 mL

IL-27B Polyclonal Antibody

Sign In for Pricing
View Details
IL-27B Polyclonal Antibody
MBS2579024-02 0.1 mL

IL-27B Polyclonal Antibody

Sign In for Pricing
View Details