Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0055 (TP_0055)

This Recombinant Treponema pallidum Uncharacterized protein TP_0055 (TP_0055) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0055

UniProt

O83094

Expression Region

1-78

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQIRLFAQSALVSVMGMGMVFAFLLLLICVVRCVGALVSSFGWDRGPDEGVGAAVPAGG ALAAAIAVAVHEKARSTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr153 (NM_001034855) Rat Tagged ORF Clone Lentiviral Particle
RR214503L3V 200 µL

Gpr153 (NM_001034855) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PLCB1 Polyclonal Antibody
UB-GEN-6515 100 µL

PLCB1 Polyclonal Antibody

Sign In for Pricing
View Details
TPA (Tissue-type Plasminogen Activator, t-plasminogen Activator, t-PA, tPA, Alteplase, INN=Reteplase, Tissue-type Plasminogen Activator Chain A, Tissue-type Plasminogen Activator Chain B, PLAT) (AP) discontinued
134629-AP 100 µL

TPA (Tissue-type Plasminogen Activator, t-plasminogen Activator, t-PA, tPA, Alteplase, INN=Reteplase, Tissue-type Plasminogen Activator Chain A, Tissue-type Plasminogen Activator Chain B, PLAT) (AP) discontinued

Sign In for Pricing
View Details
Cianergoline
444535-01 1 mg

Cianergoline

Sign In for Pricing
View Details
Cianergoline
444535-02 5 mg

Cianergoline

Sign In for Pricing
View Details
PMAP36 Antibody, Biotin conjugated
CSB-PA344230HD01PI-01 50 µg

PMAP36 Antibody, Biotin conjugated

Sign In for Pricing
View Details