Recombinant Photosystem II reaction center protein H (psbH)
This Recombinant Photosystem II reaction center protein H (psbH) spans the amino acid sequence from region 1-78.
Product Specifications
Product Name Alternative
Photosystem II reaction center protein H, PSII-H, Photosystem II 10 kDa phosphoprotein
UniProt
Q0P3N4
Expression Region
1-78
Origin
Ostreococcus tauri
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAAKDSKLAGTGKVTALGTALRPLNSEYGKVAPGWGTTILMSVFIGLFAVFIVILLEIYN KSLILDNVGVNWLSSTGL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470096-100 1x 100 µL
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471037-100 1x 100 µL
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942304-500 1x 500 µL
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941906-100 1x 100 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details