Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3IZ13

Expression Region

1-78

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDIAEMGKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFA EALGIFSFLIALLLMFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Methyl ß-Hydroxyl Phentermine
CS-T-82019 1 Each

N-Methyl ß-Hydroxyl Phentermine

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-human CD186 (CXCR6)
E16FHK186-100 100 Tests

Alexa Fluor® 647 anti-human CD186 (CXCR6)

Sign In for Pricing
View Details
TNF Receptor Associated Factor 2 (TRAF2) Antibody
abx211801-01 50 µL

TNF Receptor Associated Factor 2 (TRAF2) Antibody

Sign In for Pricing
View Details
TNF Receptor Associated Factor 2 (TRAF2) Antibody
abx211801-02 100 µL

TNF Receptor Associated Factor 2 (TRAF2) Antibody

Sign In for Pricing
View Details
LY 3200882 10mg
A16816-10 10 mg

LY 3200882 10mg

Sign In for Pricing
View Details
Radixin
AP86897 1 mg

Radixin

Sign In for Pricing
View Details