Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3IZ13

Expression Region

1-78

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDIAEMGKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFA EALGIFSFLIALLLMFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcerg1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
46373116 3x 1.0 µg

Tcerg1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
MTF2 Protein Vector (Rat) (pPM-C-His)
PV283541 500 ng

MTF2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
GPR161 siRNA (Human)
orb1859991-01 15 nmol

GPR161 siRNA (Human)

Sign In for Pricing
View Details
GPR161 siRNA (Human)
orb1859991-02 30 nmol

GPR161 siRNA (Human)

Sign In for Pricing
View Details
Canine Trypanosoma antiserum
Trypanosoma antibody positive 0.5 mL

Canine Trypanosoma antiserum

Sign In for Pricing
View Details
SAP 130 (h) -PR
sc-94536-PR 10 µM - 20 µL

SAP 130 (h) -PR

Sign In for Pricing
View Details