Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0270 (MJ0270)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0270 (MJ0270) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0270

UniProt

Q57718

Expression Region

1-78

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKREKMRPKSSTILILLMSVLILLLSIDILANHIIIKVDGYYYDGLGQKLAMKDVIPI NASFNKIKSQLEKSMKFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostate Specific Antigen (KLK3) Rabbit Polyclonal Antibody
TA377864 100 µL

Prostate Specific Antigen (KLK3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Qrfpr Mouse Gene Knockout Kit (CRISPR)
KN514307 1 Kit

Qrfpr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NUDT22 (NM_001128613) Human Over-expression Lysate
LY426975 100 µg

NUDT22 (NM_001128613) Human Over-expression Lysate

Sign In for Pricing
View Details
HOXA10 Goat Polyclonal Antibody
AP32972PU-N 100 µg

HOXA10 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Serotonin N acetyltransferase (AANAT) (NM_001088) Human Over-expression Lysate
LC421333 20 µg

Serotonin N acetyltransferase (AANAT) (NM_001088) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ITPRIPL1 activation kit by CRISPRa
GA115768 1 Kit

Human ITPRIPL1 activation kit by CRISPRa

Sign In for Pricing
View Details