Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0270 (MJ0270)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0270 (MJ0270) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0270

UniProt

Q57718

Expression Region

1-78

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKREKMRPKSSTILILLMSVLILLLSIDILANHIIIKVDGYYYDGLGQKLAMKDVIPI NASFNKIKSQLEKSMKFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin C (SCG2) Mouse Monoclonal Antibody [Clone ID: OTI3F12]
CF811982 100 µg

Chromogranin C (SCG2) Mouse Monoclonal Antibody [Clone ID: OTI3F12]

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), Biotin conjugate, 0.1mg/mL
BNCB1707-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MNS1 Mouse Monoclonal Antibody [Clone ID: OTI1A9]
CF810320 100 µg

MNS1 Mouse Monoclonal Antibody [Clone ID: OTI1A9]

Sign In for Pricing
View Details
NR2C2 (NM_003298) Human Over-expression Lysate
LC401137 20 µg

NR2C2 (NM_003298) Human Over-expression Lysate

Sign In for Pricing
View Details
Brk (PTK6) Rabbit Polyclonal Antibody
TA362738 100 µL

Brk (PTK6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TSPYL6 (NM_001003937) Human Over-expression Lysate
LY424038 100 µg

TSPYL6 (NM_001003937) Human Over-expression Lysate

Sign In for Pricing
View Details